Lineage for d1xdkb_ (1xdk B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543656Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)
  7. 543659Species Mouse (Mus musculus) [TaxId:10090] [117012] (1 PDB entry)
  8. 543660Domain d1xdkb_: 1xdk B: [115165]
    Other proteins in same PDB: d1xdka_, d1xdke_

Details for d1xdkb_

PDB Entry: 1xdk (more details), 2.9 Å

PDB Description: crystal structure of the rarbeta/rxralpha ligand binding domain heterodimer in complex with 9-cis retinoic acid and a fragment of the trap220 coactivator

SCOP Domain Sequences for d1xdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdkb_ a.123.1.1 (B:) Retinoic acid receptor beta (RAR-beta) {Mouse (Mus musculus)}
aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
pltps

SCOP Domain Coordinates for d1xdkb_:

Click to download the PDB-style file with coordinates for d1xdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1xdkb_: