![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117012] (1 PDB entry) Uniprot P22605 209-453 |
![]() | Domain d1xdkb_: 1xdk B: [115165] Other proteins in same PDB: d1xdka_, d1xdke_ complexed with 9cr |
PDB Entry: 1xdk (more details), 2.9 Å
SCOPe Domain Sequences for d1xdkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdkb_ a.123.1.1 (B:) Retinoic acid receptor beta (RAR-beta) {Mouse (Mus musculus) [TaxId: 10090]} aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe pltps
Timeline for d1xdkb_: