Lineage for d1xdka_ (1xdk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729508Species Mouse (Mus musculus) [TaxId:10090] [48512] (3 PDB entries)
    Uniprot P28700 232-463
  8. 2729511Domain d1xdka_: 1xdk A: [115164]
    Other proteins in same PDB: d1xdkb_, d1xdkf_
    complexed with co-activator peptide
    complexed with 9cr

Details for d1xdka_

PDB Entry: 1xdk (more details), 2.9 Å

PDB Description: crystal structure of the rarbeta/rxralpha ligand binding domain heterodimer in complex with 9-cis retinoic acid and a fragment of the trap220 coactivator
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xdka_:

Sequence, based on SEQRES records: (download)

>d1xdka_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus) [TaxId: 10090]}
anedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakr
iphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgai
fdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayck
hkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d1xdka_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus) [TaxId: 10090]}
anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
lpalrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1xdka_:

Click to download the PDB-style file with coordinates for d1xdka_.
(The format of our PDB-style files is described here.)

Timeline for d1xdka_: