Lineage for d1xdka_ (1xdk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009236Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2009299Species Mouse (Mus musculus) [TaxId:10090] [48512] (3 PDB entries)
    Uniprot P28700 232-463
  8. 2009302Domain d1xdka_: 1xdk A: [115164]
    Other proteins in same PDB: d1xdkb_, d1xdkf_
    complexed with co-activator peptide
    complexed with rea

Details for d1xdka_

PDB Entry: 1xdk (more details), 2.9 Å

PDB Description: Crystal Structure of the RARbeta/RXRalpha Ligand Binding Domain Heterodimer in Complex with 9-cis Retinoic Acid and a Fragment of the TRAP220 Coactivator
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xdka_:

Sequence, based on SEQRES records: (download)

>d1xdka_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus) [TaxId: 10090]}
anedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakr
iphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgai
fdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayck
hkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d1xdka_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus) [TaxId: 10090]}
anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
lpalrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1xdka_:

Click to download the PDB-style file with coordinates for d1xdka_.
(The format of our PDB-style files is described here.)

Timeline for d1xdka_: