Lineage for d1xcxa1 (1xcx A:404-496)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400370Protein Animal alpha-amylase [51024] (3 species)
  7. 2400371Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2400392Domain d1xcxa1: 1xcx A:404-496 [115136]
    Other proteins in same PDB: d1xcxa2
    complexed with ca, cl, iab, nag

Details for d1xcxa1

PDB Entry: 1xcx (more details), 1.9 Å

PDB Description: Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1xcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcxa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1xcxa1:

Click to download the PDB-style file with coordinates for d1xcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1xcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xcxa2