PDB entry 1xcx

View 1xcx on RCSB PDB site
Description: Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
Class: hydrolase
Keywords: amylase, acarbose, acarbose analogues, inhibitor, acarviosine, isoacarbose, enzyme, catalysis, enzyme mechanism, HYDROLASE
Deposited on 2004-09-03, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04746 (0-495)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xcxa1, d1xcxa2
  • Heterogens: NAG, IAB, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xcxA (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl