Lineage for d1xcxa1 (1xcx A:404-496)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566046Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 566074Protein Animal alpha-amylase [51024] (3 species)
  7. 566075Species Human (Homo sapiens) [TaxId:9606] [51026] (27 PDB entries)
  8. 566085Domain d1xcxa1: 1xcx A:404-496 [115136]
    Other proteins in same PDB: d1xcxa2
    complexed with ca, cl, iab, nag

Details for d1xcxa1

PDB Entry: 1xcx (more details), 1.9 Å

PDB Description: acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts

SCOP Domain Sequences for d1xcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcxa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1xcxa1:

Click to download the PDB-style file with coordinates for d1xcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1xcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xcxa2