![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
![]() | Protein Beta-chimaerin, C-terminal domain [116996] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [116997] (1 PDB entry) Uniprot P52757 23-468 |
![]() | Domain d1xa6a1: 1xa6 A:271-466 [115030] Other proteins in same PDB: d1xa6a2, d1xa6a3 complexed with zn |
PDB Entry: 1xa6 (more details), 3.2 Å
SCOPe Domain Sequences for d1xa6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} kvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdg ekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevl mllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmry qklivqilienedvlf
Timeline for d1xa6a1: