Lineage for d1xa6a1 (1xa6 A:271-466)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725244Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2725245Protein Beta-chimaerin, C-terminal domain [116996] (1 species)
  7. 2725246Species Human (Homo sapiens) [TaxId:9606] [116997] (1 PDB entry)
    Uniprot P52757 23-468
  8. 2725247Domain d1xa6a1: 1xa6 A:271-466 [115030]
    Other proteins in same PDB: d1xa6a2, d1xa6a3
    complexed with zn

Details for d1xa6a1

PDB Entry: 1xa6 (more details), 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin
PDB Compounds: (A:) Beta2-chimaerin

SCOPe Domain Sequences for d1xa6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdg
ekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevl
mllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmry
qklivqilienedvlf

SCOPe Domain Coordinates for d1xa6a1:

Click to download the PDB-style file with coordinates for d1xa6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xa6a1: