Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Beta-chimaerin, N-terminal domain [118052] (1 species) includes N-terminal tail and the linker to the next domain |
Species Human (Homo sapiens) [TaxId:9606] [118053] (1 PDB entry) Uniprot P52757 23-468 |
Domain d1xa6a2: 1xa6 A:21-161 [115031] Other proteins in same PDB: d1xa6a1, d1xa6a3 complexed with zn |
PDB Entry: 1xa6 (more details), 3.2 Å
SCOPe Domain Sequences for d1xa6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayil resqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaae yiskmttnpiyehigyatllr
Timeline for d1xa6a2: