Lineage for d1xa6a1 (1xa6 A:271-466)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542636Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 542637Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) (S)
  5. 542638Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins)
    Pfam 00620
  6. 542639Protein Beta-chimaerin, C-terminal domain [116996] (1 species)
  7. 542640Species Human (Homo sapiens) [TaxId:9606] [116997] (1 PDB entry)
  8. 542641Domain d1xa6a1: 1xa6 A:271-466 [115030]
    Other proteins in same PDB: d1xa6a2, d1xa6a3
    complexed with zn

Details for d1xa6a1

PDB Entry: 1xa6 (more details), 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin

SCOP Domain Sequences for d1xa6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens)}
kvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdg
ekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevl
mllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmry
qklivqilienedvlf

SCOP Domain Coordinates for d1xa6a1:

Click to download the PDB-style file with coordinates for d1xa6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xa6a1: