Lineage for d1xa0b1 (1xa0 B:2-118,B:295-327)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2047809Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2047810Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2047938Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 protein domains)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2048146Protein B. subtilis YhfP homologue [117169] (1 species)
  7. 2048147Species Bacillus stearothermophilus [TaxId:1422] [117170] (1 PDB entry)
    Uniprot Q5L022; 96% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 2048149Domain d1xa0b1: 1xa0 B:2-118,B:295-327 [115023]
    Other proteins in same PDB: d1xa0a2, d1xa0b2
    Structural genomics target
    complexed with cl, so4

Details for d1xa0b1

PDB Entry: 1xa0 (more details), 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus
PDB Compounds: (B:) Putative NADPH Dependent oxidoreductases

SCOPe Domain Sequences for d1xa0b1:

Sequence, based on SEQRES records: (download)

>d1xa0b1 b.35.1.2 (B:2-118,B:295-327) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
fvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgXle
riaqeislaelpqalkrilrgelrgrtvvrl

Sequence, based on observed residues (ATOM records): (download)

>d1xa0b1 b.35.1.2 (B:2-118,B:295-327) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
fvpgidlagvvvssqhpegdeviatgyeigvthfggyseyarlhgewlvplpkgXleria
qeislaelpqalkrilrgelrgrtvvrl

SCOPe Domain Coordinates for d1xa0b1:

Click to download the PDB-style file with coordinates for d1xa0b1.
(The format of our PDB-style files is described here.)

Timeline for d1xa0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xa0b2