PDB entry 1xa0

View 1xa0 on RCSB PDB site
Description: Crystal Structure of MCSG Target APC35536 from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, MCSG, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-24, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative NADPH Dependent oxidoreductases
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XA0 (0-327)
    Domains in SCOPe 2.07: d1xa0a1, d1xa0a2
  • Chain 'B':
    Compound: Putative NADPH Dependent oxidoreductases
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XA0
    Domains in SCOPe 2.07: d1xa0b1, d1xa0b2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa0A (A:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmrygg
    avavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaq
    eislaelpqalkrilrgelrgrtvvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa0A (A:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlareldkqrwaaavdpvggrtlatvlsrmryggavavsgltg
    gaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaqeislaelpq
    alkrilrgelrgrtvvrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xa0B (B:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmrygg
    avavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaq
    eislaelpqalkrilrgelrgrtvvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa0B (B:)
    safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
    fvpgidlagvvvssqhpegdeviatgyeigvthfggyseyarlhgewlvplpkgltlkea
    maigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveastgka
    aehdylrvlgakevlaerirpldkqrwaaavdpvggrtlatvlsrmryggavavsgltgg
    aevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaqeislaelpqa
    lkrilrgelrgrtvvrl