SCOPe 2.08: Domain d1xa0a1: 1xa0 A:1-118,A:295-328

Lineage for d1xa0a1 (1xa0 A:1-118,A:295-328)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein B. subtilis YhfP homologue [117169] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117170] (1 PDB entry)
   Uniprot Q5L022; 96% sequence identity; Geobacillus kaustophilus TaxID:1462

8. Domain d1xa0a1: 1xa0 A:1-118,A:295-328 [115021]
   Other proteins in same PDB: d1xa0a2, d1xa0b2
   Structural genomics target
   complexed with cl, so4

Details for d1xa0a1

PDB Entry: 1xa0, 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus

PDB Compounds: (A:) Putative NADPH Dependent oxidoreductases

SCOPe Domain Sequences for d1xa0a1:

Sequence; same for both SEQRES and ATOM records:

>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgXl
eriaqeislaelpqalkrilrgelrgrtvvrla

Timeline for d1xa0a1:

• d1xa0a1 first appeared in SCOP 1.71
  
• d1xa0a1 appears in SCOPe 2.07