Class b: All beta proteins [48724] (180 folds) |
Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) some topological similarity to osmotin |
Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins) Pfam PF07367 |
Protein Lectin xcl [117120] (1 species) |
Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry) Uniprot Q8WZC9 |
Domain d1x99b_: 1x99 B: [114979] Other proteins in same PDB: d1x99a2 complexed with edo, so4 |
PDB Entry: 1x99 (more details), 1.4 Å
SCOPe Domain Sequences for d1x99b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x99b_ b.97.1.2 (B:) Lectin xcl {Xerocomus chrysenteron [TaxId: 5386]} msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai gtkvevvytvaegnnleanvifs
Timeline for d1x99b_: