PDB entry 1x99

View 1x99 on RCSB PDB site
Description: X-ray crystal structure of Xerocomus chrysenteron lectin XCL at 1.4 Angstroms resolution, mutated at Q46M, V54M, L58M
Class: sugar binding protein
Keywords: fungal lectin, SUGAR BINDING PROTEIN
Deposited on 2004-08-20, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.174
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Xerocomus chrysenteron [TaxId:5386]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZC9 (2-144)
      • cloning artifact (0-1)
      • modified residue (2)
      • engineered (47)
      • engineered (55)
      • engineered (59)
    Domains in SCOPe 2.07: d1x99a1, d1x99a2
  • Chain 'B':
    Compound: lectin
    Species: Xerocomus chrysenteron [TaxId:5386]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZC9 (2-144)
      • modified residue (2)
      • engineered (47)
      • engineered (55)
      • engineered (59)
    Domains in SCOPe 2.07: d1x99b_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x99A (A:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x99B (B:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x99B (B:)
    msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst
    kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
    gtkvevvytvaegnnleanvifs