SCOPe 2.08: Domain d1x99a1: 1x99 A:3-145

Lineage for d1x99a1 (1x99 A:3-145)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein Lectin xcl [117120] (1 species)

7. Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)
   Uniprot Q8WZC9

8. Domain d1x99a1: 1x99 A:3-145 [114978]
   Other proteins in same PDB: d1x99a2
   complexed with edo, so4

Details for d1x99a1

PDB Entry: 1x99, 1.4 Å

PDB Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1x99a1:

Sequence; same for both SEQRES and ATOM records:

>d1x99a1 b.97.1.2 (A:3-145) Lectin xcl {Xerocomus chrysenteron [TaxId: 5386]}
msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst
kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
gtkvevvytvaegnnleanvifs

Timeline for d1x99a1:

• d1x99a1 first appeared in SCOP 1.71, called d1x99a_
  
• d1x99a1 appears in SCOPe 2.07