Lineage for d1x99a1 (1x99 A:3-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820489Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2820490Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2820512Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
    Pfam PF07367
  6. 2820513Protein Lectin xcl [117120] (1 species)
  7. 2820514Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)
    Uniprot Q8WZC9
  8. 2820515Domain d1x99a1: 1x99 A:3-145 [114978]
    Other proteins in same PDB: d1x99a2
    complexed with edo, so4

Details for d1x99a1

PDB Entry: 1x99 (more details), 1.4 Å

PDB Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1x99a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x99a1 b.97.1.2 (A:3-145) Lectin xcl {Xerocomus chrysenteron [TaxId: 5386]}
msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst
kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
gtkvevvytvaegnnleanvifs

SCOPe Domain Coordinates for d1x99a1:

Click to download the PDB-style file with coordinates for d1x99a1.
(The format of our PDB-style files is described here.)

Timeline for d1x99a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x99a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1x99b_