SCOP 1.71: Domain d1x99b_: 1x99 B:

Lineage for d1x99b_ (1x99 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
   Pfam 07367

6. Protein Lectin xcl [117120] (1 species)

7. Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)

8. Domain d1x99b_: 1x99 B: [114979]
   complexed with edo, so4; mutant

Details for d1x99b_

PDB Entry: 1x99, 1.4 Å

PDB Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m

SCOP Domain Sequences for d1x99b_:

Sequence; same for both SEQRES and ATOM records:

>d1x99b_ b.97.1.2 (B:) Lectin xcl {Xerocomus chrysenteron}
msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfmst
kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
gtkvevvytvaegnnleanvifs

Timeline for d1x99b_:

• d1x99b_ is new in SCOP 1.71
  
• d1x99b_ appears in SCOP 1.73
  
• d1x99b_ appears in the current release, SCOPe 2.08