Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.29: Restriction endonuclease EcoO109IR [117635] (1 protein) |
Protein Restriction endonuclease EcoO109IR [117636] (1 species) |
Species Escherichia coli [TaxId:562] [117637] (2 PDB entries) Uniprot Q9RPJ3 |
Domain d1wteb_: 1wte B: [114877] protein/DNA complex; complexed with na |
PDB Entry: 1wte (more details), 1.9 Å
SCOPe Domain Sequences for d1wteb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wteb_ c.52.1.29 (B:) Restriction endonuclease EcoO109IR {Escherichia coli [TaxId: 562]} mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie kfkehvakkyneqvlnadgtaqwhkllemine
Timeline for d1wteb_: