SCOPe 2.08: Domain d1wteb_: 1wte B:

Lineage for d1wteb_ (1wte B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.29: Restriction endonuclease EcoO109IR [117635] (1 protein)

6. Protein Restriction endonuclease EcoO109IR [117636] (1 species)

7. Species Escherichia coli [TaxId:562] [117637] (2 PDB entries)
   Uniprot Q9RPJ3

8. Domain d1wteb_: 1wte B: [114877]
   protein/DNA complex; complexed with na

Details for d1wteb_

PDB Entry: 1wte, 1.9 Å

PDB Description: Crystal structure of type II restrcition endonuclease, EcoO109I complexed with cognate DNA

PDB Compounds: (B:) EcoO109IR

SCOPe Domain Sequences for d1wteb_:

Sequence; same for both SEQRES and ATOM records:

>d1wteb_ c.52.1.29 (B:) Restriction endonuclease EcoO109IR {Escherichia coli [TaxId: 562]}
mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
kfkehvakkyneqvlnadgtaqwhkllemine

Timeline for d1wteb_:

• d1wteb_ first appeared in SCOP 1.71
  
• d1wteb_ appears in SCOPe 2.07