PDB entry 1wte

View 1wte on RCSB PDB site
Description: Crystal structure of type II restrcition endonuclease, EcoO109I complexed with cognate DNA
Class: hydrolase/DNA
Keywords: Restriction endonuclease, DNA complex, hydrolase/DNA COMPLEX
Deposited on 2004-11-22, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EcoO109IR
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wtea_
  • Chain 'B':
    Compound: EcoO109IR
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wteb_
  • Chain 'X':
    Compound: 5'-d(*ap*cp*cp*gp*gp*gp*cp*cp*cp*tp*gp*cp*c)-3'
  • Chain 'Y':
    Compound: 5'-d(*gp*gp*cp*ap*gp*gp*gp*cp*cp*cp*gp*gp*t)-3'
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wteA (A:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
    ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
    ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
    kfkehvakkyneqvlnadgtaqwhkllemine
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wteB (B:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
    ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
    ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
    kfkehvakkyneqvlnadgtaqwhkllemine
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.