Lineage for d1wtea_ (1wte A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882673Family c.52.1.29: Restriction endonuclease EcoO109IR [117635] (1 protein)
  6. 2882674Protein Restriction endonuclease EcoO109IR [117636] (1 species)
  7. 2882675Species Escherichia coli [TaxId:562] [117637] (2 PDB entries)
    Uniprot Q9RPJ3
  8. 2882676Domain d1wtea_: 1wte A: [114876]
    protein/DNA complex; complexed with na

Details for d1wtea_

PDB Entry: 1wte (more details), 1.9 Å

PDB Description: Crystal structure of type II restrcition endonuclease, EcoO109I complexed with cognate DNA
PDB Compounds: (A:) EcoO109IR

SCOPe Domain Sequences for d1wtea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtea_ c.52.1.29 (A:) Restriction endonuclease EcoO109IR {Escherichia coli [TaxId: 562]}
mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
kfkehvakkyneqvlnadgtaqwhkllemine

SCOPe Domain Coordinates for d1wtea_:

Click to download the PDB-style file with coordinates for d1wtea_.
(The format of our PDB-style files is described here.)

Timeline for d1wtea_: