Lineage for d1wpgd2 (1wpg D:344-360,D:600-750)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1187782Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
    interrupted by a large insertion, domain N
  6. 1187783Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 1187784Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (14 PDB entries)
    Uniprot P04191
  8. 1187788Domain d1wpgd2: 1wpg D:344-360,D:600-750 [114819]
    Other proteins in same PDB: d1wpga1, d1wpga3, d1wpga4, d1wpgb1, d1wpgb3, d1wpgb4, d1wpgc1, d1wpgc3, d1wpgc4, d1wpgd1, d1wpgd3, d1wpgd4
    complexed with adp, mf4, mg, na, tg1

Details for d1wpgd2

PDB Entry: 1wpg (more details), 2.3 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with MGF4
PDB Compounds: (D:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1wpgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpgd2 c.108.1.7 (D:344-360,D:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d1wpgd2:

Click to download the PDB-style file with coordinates for d1wpgd2.
(The format of our PDB-style files is described here.)

Timeline for d1wpgd2: