Lineage for d1wpgd1 (1wpg D:125-239)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1139304Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 1139305Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 1139306Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 1139307Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (14 PDB entries)
    Uniprot P04191
  8. 1139311Domain d1wpgd1: 1wpg D:125-239 [114818]
    Other proteins in same PDB: d1wpga2, d1wpga3, d1wpga4, d1wpgb2, d1wpgb3, d1wpgb4, d1wpgc2, d1wpgc3, d1wpgc4, d1wpgd2, d1wpgd3, d1wpgd4
    complexed with adp, mf4, mg, na, tg1

Details for d1wpgd1

PDB Entry: 1wpg (more details), 2.3 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with MGF4
PDB Compounds: (D:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1wpgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpgd1 b.82.7.1 (D:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d1wpgd1:

Click to download the PDB-style file with coordinates for d1wpgd1.
(The format of our PDB-style files is described here.)

Timeline for d1wpgd1: