Lineage for d1wpgc4 (1wpg C:1-124,C:240-343,C:751-994)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239459Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 1239460Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 1239461Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 1239462Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 1239463Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (14 PDB entries)
    Uniprot P04191
  8. 1239466Domain d1wpgc4: 1wpg C:1-124,C:240-343,C:751-994 [114817]
    Other proteins in same PDB: d1wpga1, d1wpga2, d1wpga3, d1wpgb1, d1wpgb2, d1wpgb3, d1wpgc1, d1wpgc2, d1wpgc3, d1wpgd1, d1wpgd2, d1wpgd3
    complexed with adp, mf4, mg, na, tg1

Details for d1wpgc4

PDB Entry: 1wpg (more details), 2.3 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with MGF4
PDB Compounds: (C:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1wpgc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpgc4 f.33.1.1 (C:1-124,C:240-343,C:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d1wpgc4:

Click to download the PDB-style file with coordinates for d1wpgc4.
(The format of our PDB-style files is described here.)

Timeline for d1wpgc4: