Lineage for d1wpba_ (1wpb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.233: YfbU-like [116959] (1 superfamily)
    multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes
  4. Superfamily a.233.1: YfbU-like [116960] (1 family) (S)
    automatically mapped to Pfam PF03887
  5. Family a.233.1.1: YfbU-like [116961] (2 proteins)
    Pfam PF03887
  6. Protein Hypothetical protein YfbU [116962] (1 species)
  7. Species Escherichia coli [TaxId:562] [116963] (1 PDB entry)
    Uniprot P0A8W8
  8. Domain d1wpba_: 1wpb A: [114783]
    Structural genomics target
    complexed with cl, gol

Details for d1wpba_

PDB Entry: 1wpb (more details), 2 Å

PDB Description: Structure of Escherichia coli yfbU gene product
PDB Compounds: (A:) hypothetical protein yfbU

SCOPe Domain Sequences for d1wpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpba_ a.233.1.1 (A:) Hypothetical protein YfbU {Escherichia coli [TaxId: 562]}
qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina

SCOPe Domain Coordinates for d1wpba_ are not available.

Timeline for d1wpba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wpbb_, d1wpbc_, d1wpbd_, d1wpbe_, d1wpbf_, d1wpbg_, d1wpbh_, d1wpbi_, d1wpbj_, d1wpbk_, d1wpbl_, d1wpbm_, d1wpbn_, d1wpbo_, d1wpbp_