PDB entry 1wpb

View 1wpb on RCSB PDB site
Description: Structure of Escherichia coli yfbU gene product
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, NCS, regulatory protein, protein structure initiative, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-09-01, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpba_
  • Chain 'B':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbb_
  • Chain 'C':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbc_
  • Chain 'D':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbd_
  • Chain 'E':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbe_
  • Chain 'F':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbf_
  • Chain 'G':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbg_
  • Chain 'H':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbh_
  • Chain 'I':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbi_
  • Chain 'J':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbj_
  • Chain 'K':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbk_
  • Chain 'L':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbl_
  • Chain 'M':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbm_
  • Chain 'N':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbn_
  • Chain 'O':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbo_
  • Chain 'P':
    Compound: hypothetical protein yfbU
    Species: Escherichia coli [TaxId:562]
    Gene: yfbU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpbp_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wpbA (A:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbA (A:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wpbB (B:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbB (B:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wpbC (C:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbC (C:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wpbD (D:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbD (D:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wpbE (E:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbE (E:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wpbF (F:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbF (F:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wpbG (G:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbG (G:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wpbH (H:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbH (H:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1wpbI (I:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbI (I:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1wpbJ (J:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbJ (J:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1wpbK (K:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbK (K:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1wpbL (L:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbL (L:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1wpbM (M:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbM (M:)
    estmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelkee
    tcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegry
    thfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1wpbN (N:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbN (N:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1wpbO (O:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbO (O:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1wpbP (P:)
    ghmiqestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefg
    elkeetcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvn
    vegrythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpbP (P:)
    qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
    etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
    ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina