Lineage for d1wpba_ (1wpb A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546351Fold a.233: YfbU-like [116959] (1 superfamily)
    multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes
  4. 546352Superfamily a.233.1: YfbU-like [116960] (1 family) (S)
  5. 546353Family a.233.1.1: YfbU-like [116961] (1 protein)
    Pfam 03887
  6. 546354Protein Hypothetical protein YfbU [116962] (1 species)
  7. 546355Species Escherichia coli [TaxId:562] [116963] (1 PDB entry)
  8. 546356Domain d1wpba_: 1wpb A: [114783]

Details for d1wpba_

PDB Entry: 1wpb (more details), 2 Å

PDB Description: Structure of Escherichia coli yfbU gene product

SCOP Domain Sequences for d1wpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpba_ a.233.1.1 (A:) Hypothetical protein YfbU {Escherichia coli}
qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina

SCOP Domain Coordinates for d1wpba_:

Click to download the PDB-style file with coordinates for d1wpba_.
(The format of our PDB-style files is described here.)

Timeline for d1wpba_: