| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.233: YfbU-like [116959] (1 superfamily) multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes |
Superfamily a.233.1: YfbU-like [116960] (1 family) ![]() |
| Family a.233.1.1: YfbU-like [116961] (1 protein) Pfam 03887 |
| Protein Hypothetical protein YfbU [116962] (1 species) |
| Species Escherichia coli [TaxId:562] [116963] (1 PDB entry) |
| Domain d1wpbn_: 1wpb N: [114796] |
PDB Entry: 1wpb (more details), 2 Å
SCOP Domain Sequences for d1wpbn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpbn_ a.233.1.1 (N:) Hypothetical protein YfbU {Escherichia coli}
qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
Timeline for d1wpbn_: