Lineage for d1wjza_ (1wjz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718905Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1718906Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 1718917Protein CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) [116760] (1 species)
  7. 1718918Species Mouse (Mus musculus) [TaxId:10090] [116761] (1 PDB entry)
    Uniprot Q91ZF0 49-129
  8. 1718919Domain d1wjza_: 1wjz A: [114717]
    Structural genomics target

Details for d1wjza_

PDB Entry: 1wjz (more details)

PDB Description: soluiotn structure of j-domain of mouse dnaj like protein
PDB Compounds: (A:) 1700030A21Rik protein

SCOPe Domain Sequences for d1wjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmaleqtlkkdwysilgadpsanmsdlkqkyqklillyhpdkqsadvpagtmee
cmqkfieidqawkilgneetkkkydlqrsgpssg

SCOPe Domain Coordinates for d1wjza_:

Click to download the PDB-style file with coordinates for d1wjza_.
(The format of our PDB-style files is described here.)

Timeline for d1wjza_: