Lineage for d1wjza_ (1wjz A:)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
Pfam 00226
Protein CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) [116760] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [116761] (1 PDB entry) 
Domain d1wjza_: 1wjz A: [114717]
Structural genomics target
Details for d1wjza_
PDB Entry: 1wjz (more details)
PDB Description: soluiotn structure of j-domain of mouse dnaj like protein
SCOP Domain Sequences for d1wjza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus)}
gssgssgmaleqtlkkdwysilgadpsanmsdlkqkyqklillyhpdkqsadvpagtmee
cmqkfieidqawkilgneetkkkydlqrsgpssg
SCOP Domain Coordinates for d1wjza_:
Click to download the PDB-style file with coordinates for d1wjza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wjza_:
- d1wjza_ is new in SCOP 1.71
- d1wjza_ appears in SCOP 1.73
- d1wjza_ appears in the current release, SCOPe 2.08, called d1wjza1
View in 3D