Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
Protein Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) [117153] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117154] (2 PDB entries) Uniprot Q96JM7 259-372, 469-562 |
Domain d1wjsa_: 1wjs A: [114710] Structural genomics target; 1st MBT repeat |
PDB Entry: 1wjs (more details)
SCOPe Domain Sequences for d1wjsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} gssgssgpynkngfkvgmklegvdpehqsvycvltvaevcgyriklhfdgysdcydfwvn adaldihpvgwcektghklhppkgykeeefnwqtylktckaqaapkslfenqnitvipsg fsgpssg
Timeline for d1wjsa_: