Lineage for d1wjsa_ (1wjs A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1121593Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1121703Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 1121704Protein Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) [117153] (1 species)
  7. 1121705Species Human (Homo sapiens) [TaxId:9606] [117154] (2 PDB entries)
    Uniprot Q96JM7 259-372, 469-562
  8. 1121706Domain d1wjsa_: 1wjs A: [114710]
    Structural genomics target; 1st MBT repeat

Details for d1wjsa_

PDB Entry: 1wjs (more details)

PDB Description: solution structure of the first mbt domain from human kiaa1798 protein
PDB Compounds: (A:) KIAA1798 protein

SCOPe Domain Sequences for d1wjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpynkngfkvgmklegvdpehqsvycvltvaevcgyriklhfdgysdcydfwvn
adaldihpvgwcektghklhppkgykeeefnwqtylktckaqaapkslfenqnitvipsg
fsgpssg

SCOPe Domain Coordinates for d1wjsa_:

Click to download the PDB-style file with coordinates for d1wjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1wjsa_: