PDB entry 1wjs

View 1wjs on RCSB PDB site
Description: Solution structure of the first mbt domain from human KIAA1798 protein
Class: protein binding
Keywords: mbt domain, KIAA1798, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1798 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fj20547
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JM7 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)
    Domains in SCOPe 2.01: d1wjsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjsA (A:)
    gssgssgpynkngfkvgmklegvdpehqsvycvltvaevcgyriklhfdgysdcydfwvn
    adaldihpvgwcektghklhppkgykeeefnwqtylktckaqaapkslfenqnitvipsg
    fsgpssg