Lineage for d1wjpa3 (1wjp A:67-107)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964751Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1964752Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1964753Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1964942Protein Zinc finger protein 295, ZNF295 [118267] (1 species)
  7. 1964943Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry)
    Uniprot Q9ULJ3 713-806
  8. 1964946Domain d1wjpa3: 1wjp A:67-107 [114707]
    Structural genomics target
    complexed with zn

Details for d1wjpa3

PDB Entry: 1wjp (more details)

PDB Description: solution structure of zf-c2h2 domains from human zinc finger protein 295
PDB Compounds: (A:) Zinc finger protein 295

SCOPe Domain Sequences for d1wjpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}
ykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg

SCOPe Domain Coordinates for d1wjpa3:

Click to download the PDB-style file with coordinates for d1wjpa3.
(The format of our PDB-style files is described here.)

Timeline for d1wjpa3: