PDB entry 1wjp

View 1wjp on RCSB PDB site
Description: Solution structure of zf-C2H2 domains from human Zinc finger protein 295
Class: metal binding protein
Keywords: zf-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 295
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fh04710
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULJ3 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.05: d1wjpa1, d1wjpa2, d1wjpa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjpA (A:)
    gssgssgaspvenkevyqcrlcnaklsslleqgsherlcrnaavcpycslrffspelkqe
    heskceykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg