Lineage for d1wjpa3 (1wjp A:67-107)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624085Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 624086Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (5 families) (S)
  5. 624087Family g.37.1.1: Classic zinc finger, C2H2 [57668] (18 proteins)
  6. 624237Protein Zinc finger protein 295, ZNF295 [118267] (1 species)
  7. 624238Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry)
  8. 624241Domain d1wjpa3: 1wjp A:67-107 [114707]
    Structural genomics target
    complexed with zn

Details for d1wjpa3

PDB Entry: 1wjp (more details)

PDB Description: solution structure of zf-c2h2 domains from human zinc finger protein 295

SCOP Domain Sequences for d1wjpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens)}
ykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg

SCOP Domain Coordinates for d1wjpa3:

Click to download the PDB-style file with coordinates for d1wjpa3.
(The format of our PDB-style files is described here.)

Timeline for d1wjpa3: