Class g: Small proteins [56992] (79 folds) |
Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (5 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (18 proteins) |
Protein Zinc finger protein 295, ZNF295 [118267] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry) |
Domain d1wjpa3: 1wjp A:67-107 [114707] Structural genomics target complexed with zn |
PDB Entry: 1wjp (more details)
SCOP Domain Sequences for d1wjpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens)} ykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg
Timeline for d1wjpa3: