SCOP 1.73: Domain d1wj9a2: 1wj9 A:88-211

Lineage for d1wj9a2 (1wj9 A:88-211)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: CRISPR-associated protein [117987] (1 family)
   duplication: contains two subdomains of this fold

5. Family d.58.53.1: CRISPR-associated protein [117988] (1 protein)

6. Protein Hypothetical protein TTHB192 [117989] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)

8. Domain d1wj9a2: 1wj9 A:88-211 [114695]
   Structural genomics target

Details for d1wj9a2

PDB Entry: 1wj9, 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus

PDB Compounds: (A:) CRISPR-associated protein

SCOP Domain Sequences for d1wj9a2:

Sequence, based on SEQRES records:

>d1wj9a2 d.58.53.1 (A:88-211) Hypothetical protein TTHB192 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

Sequence, based on observed residues (ATOM records):

>d1wj9a2 d.58.53.1 (A:88-211) Hypothetical protein TTHB192 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlktpaekvawlerrleeggfrllegergpwvqilqdtfleq
vqavlfegrlevvdperalatlrrgvgpgkalglgllsvap

Timeline for d1wj9a2:

• d1wj9a2 first appeared in SCOP 1.71
  
• d1wj9a2 appears in SCOP 1.75
  
• d1wj9a2 appears in the current release, SCOPe 2.08