Lineage for d1wj9a2 (1wj9 A:88-211)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522548Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (3 families) (S)
  5. 2522549Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins)
    duplication: contains two subdomains of this fold
  6. 2522550Protein CRISPR-associated endoribonuclease Cse3 [117989] (1 species)
  7. 2522551Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)
    Uniprot Q53WG9
  8. 2522553Domain d1wj9a2: 1wj9 A:88-211 [114695]
    Structural genomics target

Details for d1wj9a2

PDB Entry: 1wj9 (more details), 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus
PDB Compounds: (A:) CRISPR-associated protein

SCOPe Domain Sequences for d1wj9a2:

Sequence, based on SEQRES records: (download)

>d1wj9a2 d.58.53.1 (A:88-211) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

Sequence, based on observed residues (ATOM records): (download)

>d1wj9a2 d.58.53.1 (A:88-211) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlktpaekvawlerrleeggfrllegergpwvqilqdtfleq
vqavlfegrlevvdperalatlrrgvgpgkalglgllsvap

SCOPe Domain Coordinates for d1wj9a2:

Click to download the PDB-style file with coordinates for d1wj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1wj9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wj9a1