Lineage for d1wj9a1 (1wj9 A:1-87)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726141Superfamily d.58.53: CRISPR-associated protein [117987] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 726142Family d.58.53.1: CRISPR-associated protein [117988] (1 protein)
  6. 726143Protein Hypothetical protein TTHB192 [117989] (1 species)
  7. 726144Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)
  8. 726145Domain d1wj9a1: 1wj9 A:1-87 [114694]

Details for d1wj9a1

PDB Entry: 1wj9 (more details), 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus
PDB Compounds: (A:) CRISPR-associated protein

SCOP Domain Sequences for d1wj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj9a1 d.58.53.1 (A:1-87) Hypothetical protein TTHB192 {Thermus thermophilus [TaxId: 274]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

SCOP Domain Coordinates for d1wj9a1:

Click to download the PDB-style file with coordinates for d1wj9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wj9a2