Lineage for d1wj9a2 (1wj9 A:88-211)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605235Superfamily d.58.53: CRISPR-associated protein [117987] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 605236Family d.58.53.1: CRISPR-associated protein [117988] (1 protein)
  6. 605237Protein Hypothetical protein TTHB192 [117989] (1 species)
  7. 605238Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)
  8. 605240Domain d1wj9a2: 1wj9 A:88-211 [114695]
    Structural genomics target

Details for d1wj9a2

PDB Entry: 1wj9 (more details), 1.9 Å

PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus

SCOP Domain Sequences for d1wj9a2:

Sequence, based on SEQRES records: (download)

>d1wj9a2 d.58.53.1 (A:88-211) Hypothetical protein TTHB192 {Thermus thermophilus}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap

Sequence, based on observed residues (ATOM records): (download)

>d1wj9a2 d.58.53.1 (A:88-211) Hypothetical protein TTHB192 {Thermus thermophilus}
alkpgqrlrfrlranpakrlktpaekvawlerrleeggfrllegergpwvqilqdtfleq
vqavlfegrlevvdperalatlrrgvgpgkalglgllsvap

SCOP Domain Coordinates for d1wj9a2:

Click to download the PDB-style file with coordinates for d1wj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1wj9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wj9a1