SCOP 1.73: Domain d1wiba_: 1wib A:

Lineage for d1wiba_ (1wib A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein 60S ribosomal protein L12 [117898] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117899] (1 PDB entry)

8. Domain d1wiba_: 1wib A: [114665]
   Structural genomics target

Details for d1wiba_

PDB Entry: 1wib

PDB Description: solution structure of the n-terminal domain from mouse hypothetical protein bab22488

PDB Compounds: (A:) 60S ribosomal protein L12

SCOP Domain Sequences for d1wiba_:

Sequence; same for both SEQRES and ATOM records:

>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwk
glritvkltiqnrqaqievvpsasalsgpssg

Timeline for d1wiba_:

• d1wiba_ first appeared in SCOP 1.71
  
• d1wiba_ appears in SCOP 1.75
  
• d1wiba_ appears in the current release, SCOPe 2.08, called d1wiba1