Lineage for d1wiba_ (1wib A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859768Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 859769Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 859770Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 859771Protein 60S ribosomal protein L12 [117898] (1 species)
  7. 859772Species Mouse (Mus musculus) [TaxId:10090] [117899] (1 PDB entry)
    Uniprot P35979 2-80
  8. 859773Domain d1wiba_: 1wib A: [114665]
    Structural genomics target

Details for d1wiba_

PDB Entry: 1wib (more details)

PDB Description: solution structure of the n-terminal domain from mouse hypothetical protein bab22488
PDB Compounds: (A:) 60S ribosomal protein L12

SCOP Domain Sequences for d1wiba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwk
glritvkltiqnrqaqievvpsasalsgpssg

SCOP Domain Coordinates for d1wiba_:

Click to download the PDB-style file with coordinates for d1wiba_.
(The format of our PDB-style files is described here.)

Timeline for d1wiba_: