Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) |
Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
Protein 60S ribosomal protein L12 [117898] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117899] (1 PDB entry) Uniprot P35979 2-80 |
Domain d1wiba_: 1wib A: [114665] Structural genomics target |
PDB Entry: 1wib (more details)
SCOP Domain Sequences for d1wiba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwk glritvkltiqnrqaqievvpsasalsgpssg
Timeline for d1wiba_: