Lineage for d1wiba1 (1wib A:2-85)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946683Protein 60S ribosomal protein L12 [117898] (1 species)
  7. 2946684Species Mouse (Mus musculus) [TaxId:10090] [117899] (1 PDB entry)
    Uniprot P35979 2-80
  8. 2946685Domain d1wiba1: 1wib A:2-85 [114665]
    Other proteins in same PDB: d1wiba2, d1wiba3
    Structural genomics target

Details for d1wiba1

PDB Entry: 1wib (more details)

PDB Description: solution structure of the n-terminal domain from mouse hypothetical protein bab22488
PDB Compounds: (A:) 60S ribosomal protein L12

SCOPe Domain Sequences for d1wiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiba1 d.47.1.1 (A:2-85) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]}
ppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwkglritvk
ltiqnrqaqievvpsasalsgpss

SCOPe Domain Coordinates for d1wiba1:

Click to download the PDB-style file with coordinates for d1wiba1.
(The format of our PDB-style files is described here.)

Timeline for d1wiba1: