PDB entry 1wib

View 1wib on RCSB PDB site
Description: Solution structure of the N-terminal domain from mouse hypothetical protein BAB22488
Class: ribosome
Keywords: N-terminal domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S ribosomal protein L12
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 0710001M22
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35979 (6-84)
      • cloning artifact (0-6)
      • cloning artifact (86-89)
      • cloning artifact (91)
    Domains in SCOP 1.73: d1wiba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wibA (A:)
    gssgssgppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwk
    glritvkltiqnrqaqievvpsasalsgpssg