| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
| Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
| Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species) formerly hypothetical protein bab28848 |
| Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries) Uniprot O70133 4-89, 168-262 |
| Domain d1whqa1: 1whq A:4-89 [114649] Other proteins in same PDB: d1whqa2, d1whqa3 Structural genomics target; 1st dsRBD |
PDB Entry: 1whq (more details)
SCOPe Domain Sequences for d1whqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whqa1 d.50.1.1 (A:4-89) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]}
iknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkdaqsnaar
dfvnylvrinevkseevpavgivppp
Timeline for d1whqa1: