Lineage for d1whqa1 (1whq A:4-89)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190525Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2190526Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2190527Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
    formerly hypothetical protein bab28848
  7. 2190528Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)
    Uniprot O70133 4-89, 168-262
  8. 2190529Domain d1whqa1: 1whq A:4-89 [114649]
    Other proteins in same PDB: d1whqa2, d1whqa3
    Structural genomics target; 1st dsRBD

Details for d1whqa1

PDB Entry: 1whq (more details)

PDB Description: solution structure of the n-terminal dsrbd from hypothetical protein bab28848
PDB Compounds: (A:) RNA helicase A

SCOPe Domain Sequences for d1whqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whqa1 d.50.1.1 (A:4-89) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]}
iknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkdaqsnaar
dfvnylvrinevkseevpavgivppp

SCOPe Domain Coordinates for d1whqa1:

Click to download the PDB-style file with coordinates for d1whqa1.
(The format of our PDB-style files is described here.)

Timeline for d1whqa1: