SCOP 1.71: Domain d1whqa_: 1whq A:

Lineage for d1whqa_ (1whq A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.50: dsRBD-like [54767] (4 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (7 proteins)
   Pfam 00035

6. Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
   formerly hypothetical protein bab28848

7. Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)

8. Domain d1whqa_: 1whq A: [114649]
   Structural genomics target; 1st dsRBD

Details for d1whqa_

PDB Entry: 1whq

PDB Description: solution structure of the n-terminal dsrbd from hypothetical protein bab28848

SCOP Domain Sequences for d1whqa_:

Sequence; same for both SEQRES and ATOM records:

>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus)}
gssgssgiknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkd
aqsnaardfvnylvrinevkseevpavgivpppsgpssg

Timeline for d1whqa_:

• d1whqa_ is new in SCOP 1.71
  
• d1whqa_ appears in SCOP 1.73
  
• d1whqa_ appears in the current release, SCOPe 2.08, called d1whqa1