![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.50: dsRBD-like [54767] (4 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (7 proteins) Pfam 00035 |
![]() | Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species) formerly hypothetical protein bab28848 |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries) |
![]() | Domain d1whqa_: 1whq A: [114649] Structural genomics target; 1st dsRBD |
PDB Entry: 1whq (more details)
SCOP Domain Sequences for d1whqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus)} gssgssgiknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkd aqsnaardfvnylvrinevkseevpavgivpppsgpssg
Timeline for d1whqa_: