Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Tubulin-specific chaperone B (SKAP1) [117160] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117161] (1 PDB entry) Uniprot Q9D1E6 134-233 |
Domain d1whga1: 1whg A:8-107 [114642] Other proteins in same PDB: d1whga2, d1whga3 Structural genomics target |
PDB Entry: 1whg (more details)
SCOPe Domain Sequences for d1whga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whga1 b.34.10.1 (A:8-107) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} neelraqqeaeaaqrlseekaqasaisvgsrcevrapdhslrrgtvmyvgltdfkpgywv gvrydeplgkndgsvngkryfecqakygafvkpsavtvgd
Timeline for d1whga1: