SCOPe 2.07: Domain d1whga1: 1whg A:8-107

Lineage for d1whga1 (1whg A:8-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Tubulin-specific chaperone B (SKAP1) [117160] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117161] (1 PDB entry)
   Uniprot Q9D1E6 134-233

8. Domain d1whga1: 1whg A:8-107 [114642]
   Other proteins in same PDB: d1whga2, d1whga3
   Structural genomics target

Details for d1whga1

PDB Entry: 1whg

PDB Description: solution structure of the cap-gly domain in mouse tubulin specific chaperone b

PDB Compounds: (A:) Tubulin specific chaperone B

SCOPe Domain Sequences for d1whga1:

Sequence; same for both SEQRES and ATOM records:

>d1whga1 b.34.10.1 (A:8-107) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]}
neelraqqeaeaaqrlseekaqasaisvgsrcevrapdhslrrgtvmyvgltdfkpgywv
gvrydeplgkndgsvngkryfecqakygafvkpsavtvgd

Timeline for d1whga1:

• d1whga1 first appeared in SCOP 1.71, called d1whga_
  
• d1whga1 appears in SCOPe 2.06
  
• d1whga1 appears in the current release, SCOPe 2.08