Lineage for d1wh9a_ (1wh9 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202974Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1203001Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1203002Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1203015Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 1203043Species Mouse (Mus musculus) [TaxId:10090] [117914] (1 PDB entry)
    Uniprot P23396 17-95
  8. 1203044Domain d1wh9a_: 1wh9 A: [114637]
    Structural genomics target

Details for d1wh9a_

PDB Entry: 1wh9 (more details)

PDB Description: solution structure of the kh domain of human ribosomal protein s3
PDB Compounds: (A:) 40S ribosomal protein S3

SCOPe Domain Sequences for d1wh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel
tavvqkrfgfpegsvelyaekvatrgsgpssg

SCOPe Domain Coordinates for d1wh9a_:

Click to download the PDB-style file with coordinates for d1wh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh9a_: