Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117914] (1 PDB entry) Uniprot P23396 17-95 |
Domain d1wh9a_: 1wh9 A: [114637] Structural genomics target |
PDB Entry: 1wh9 (more details)
SCOPe Domain Sequences for d1wh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel tavvqkrfgfpegsvelyaekvatrgsgpssg
Timeline for d1wh9a_: