SCOPe 2.08: Domain d1wh9a1: 1wh9 A:8-86

Lineage for d1wh9a1 (1wh9 A:8-86)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117914] (1 PDB entry)
   Uniprot P23396 17-95

8. Domain d1wh9a1: 1wh9 A:8-86 [114637]
   Other proteins in same PDB: d1wh9a2, d1wh9a3
   Structural genomics target

Details for d1wh9a1

PDB Entry: 1wh9

PDB Description: solution structure of the kh domain of human ribosomal protein s3

PDB Compounds: (A:) 40S ribosomal protein S3

SCOPe Domain Sequences for d1wh9a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh9a1 d.52.3.1 (A:8-86) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
fkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrireltavvqkr
fgfpegsvelyaekvatrg

Timeline for d1wh9a1:

• d1wh9a1 first appeared in SCOP 1.71, called d1wh9a_
  
• d1wh9a1 appears in SCOPe 2.07